PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00017175-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family Dof
Protein Properties Length: 266aa    MW: 28744.4 Da    PI: 8.307
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00017175-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.2e-3947106261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  WALNUT_00017175-RA  47 HQAALKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRS 106
                         57889****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-3349105IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2449101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.50651105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MQDIHSIGGG GRLFGTVTGG GSGVGGGTGD RRRPHHHHHH HPQQGHHQAA LKCPRCDSLN  60
TKFCYYNNYN LSQPRHFCKS CRRYWTKGGV LRNVPVGGGC RKAKRSKPKS ASSDASTPQQ  120
QQQVQQRERK TNSNSSSESS SLTATNTNTA TEAVSAVTEV PSLSSSSNLL SLHDSKLFIS  180
NPSFEPGLQL EQGSDCGIFS EIGSFTSLIT ASNEALPFGS SGGGFGSWDW QVSGDQGLFD  240
LSNAVDQAYW SQSQWTDQDH TTLYLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8572544e-48DQ857254.1 Glycine max Dof4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468879.18e-88PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR04e-55DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A0D2PSL99e-88A0A0D2PSL9_G
STRINGPOPTR_0015s03520.12e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-32OBF binding protein 4